Advanced Search



Monoclonal Anti-RPS6KA2 antibody produced in mouse

SIGMA/WH0006196M1 - clone 1F6, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-HU2; Anti-MAPKAPK1C; Anti-RSK; Anti-RSK3; Anti-S6Kalpha; Anti-S6Kalpha2; Anti-p90RSK2; Anti-pp90RSK3; Anti-ribosomal protein S6 kinase, 90kDa, polypeptide 2

MDL Number: MFCD00676462
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0006196M1-100UG 100 µg
$406.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to RPS6KA2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to RPS6KA2 on HeLa cell. [antibody concentration 10 μg/mL]
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between MAPK3 and RPS6KA2. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-RPS6KA2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Enhanced Validation-RNAi Western blot analysis of RPS6KA2 over-expressed 293 cell line, cotransfected with RPS6KA2 Validated Chimera RNAi. Blot probed with RPS6KA2 monoclonal antibody (M01) clone 1F6. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting Western Blot analysis of RPS6KA2 expression in transfected 293T cell line by RPS6KA2 monoclonal antibody, clone 1F6. Lanes Lane 1: RPS6KA2 transfected lysate (83.2 kDa). Lane 2: Non-transfected lysate.
Western Blotting RPS6KA2 monoclonal antibody, clone 1F6 Western Blot analysis of RPS6KA2 expression in HeLa S3 NE.
Western Blotting QC Western Blot detection against Immunogen (37.07 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1F6, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC002363 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity rat, mouse, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  proximity ligation assay: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q15349 
General description: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)
Immunogen: RPS6KA2 (AAH02363, 631 a.a. ~ 733 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top