Advanced Search



Anti-SHH

SIGMA/SAB2108581 - affinity isolated antibody

Synonym: Anti- HLP3; Anti- HPE3; Anti- SMMCI; Anti- TPT; Anti-HHG1

Product Type: Product-on-demand

Catalog Number PKG Qty. Price Quantity
45-SAB2108581-100UL 100 µL
$541.00
1/EA
Add To Favorites
Immunohistochemistry Anti-SHH: Cat. No. SAB2108581: Immunohistochemistry of SHH in Chicken Embryos tissue with SHH antibody at 1μg/mL.
Immunohistochemistry Immunohistochemistry of SHH in Chicken embryos with SHH antibody at 4-8 μg/mL
Immunohistochemistry Immunohistochemistry of SHH in Human glioma with SHH antibody at 4-8 μg/mL
Immunohistochemistry Immunohistochemistry of SHH in Human Urinary Bladder with SHH antibody at 4-8 μg/mL
Immunoblotting Cell Type: HepG2 (Cat. No. SAB2108581). Lanes 1. Antibody dilution (concentration) 1.0 μg/mL in cell type HepG2
Western Blotting Western Blot of SHH in Human Stomach Tumor with SHH antibody at 1 μg/mL
Western Blotting Western Blot of SHH in Mouse Brain with SHH antibody at 1 μg/mL

 

accession no. NM_000193
antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5-1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 28 kDa
Quality Level 100 
shipped in wet ice
species reactivity guinea pig, human, horse, mouse, rabbit, rat, dog
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: suitable
  immunohistochemistry: suitable
UniProt accession no. Q15465 
Biochem/physiol Actions: SHH is a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE). It is also thought that mutations in its gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.This gene, which is expressed only during embryogenesis, encodes a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. In addition, it is thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the N terminal region of human SHH
Other Notes: Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top