Advanced Search



Monoclonal Anti-SPA17 antibody produced in mouse

SIGMA/SAB1403268 - clone 3B6, purified immunoglobulin, buffered aqueous solution

Synonym: SP17; SP17-1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1403268-100UG 100 µg
$541.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of SPA17 expression in transfected 293T cell line by SPA17 monoclonal antibody, clone 3B6. Lanes Lane 1: SPA17 transfected lysate (Predicted MW: 17.4 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.63 kDa).
ELISA Detection limit for recombinant GST tagged SPA17 is 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3B6, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG2aκ
mol wt antigen ~37 kDa
NCBI accession no. NM_017425 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) capture ELISA: suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q15506 
Biochem/physiol Actions: Sperm autoantigenic protein 17 (SPA17) functions as a testis specific antigen. It also mediates signal transduction, protein synthesis and unregulated growth in proliferating and neoplastic cells. Overexpression of this protein decreases the resistance of epithelial ovarian carcinoma to chemotherapy. It regulates protein kinase A-independent AKAP (A-kinase anchoring proteins) complex in both germinal and somatic cells.160 The gene is associated with rheumatoid arthritis (RA).
General description: Sperm autoantigenic protein 17 (SPA17) gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22. SPA17 gene is located on human chromosome 11q24.2. This antigenic protein contains 151 amino acids and has a molecular weight of 17.4 kDa. This protein is highly expressed in testis and in somatic tissues.
Immunogen: SPA17 (NP_059121, 51 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEE
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top