Advanced Search



Anti-PEBP4 antibody produced in rabbit

SIGMA/HPA025064 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-AC105046.10 antibody produced in rabbit; Anti-PEBP-4; Anti-Phosphatidylethanolamine-binding protein 4; Anti-Protein cousin-of-RKIP 1; Anti-hPEBP4

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA025064-100UL 100 µL
$598.00
1/EA
Add To Favorites
Immunohistochemistry JOURNAL CITATION: Rewiring of human lung cell lineage and mitotic networks in lung adenocarcinomas. By: Kim, I. J., Quigley, D., et al. in Nat Commun, 2013. PubMed ID: 23591868 Image collected and cropped by CiteAb from the following publication, (http://www.nature.com/articles/ncomms2660), provided under a CC-BY license. Image might reflect a new usage that is not reflected in claims on product description or independently verified by Merck KGaA, Darmstadt, Germany. For Research Use Only. Not for use in diagnostic procedures.
Immunohistochemistry Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Western Blotting Western blot analysis in human skeletal muscle tissue.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous glycerol solution
immunogen sequence EGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQDSPTLQAPRERASEPKHK
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunohistochemistry: 1:200-1:500
Application: All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols   and other useful information.
Application: Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper) 
Biochem/physiol Actions: PEBP4 (phosphatidylethanolamine binding protein 4) regulates apoptosis by associating with Raf1 (proto-oncogene serine/threonine-protein kinase) and MEK1 (MAPK/ERK kinase 1). This association blocks TNFα (tumor necrosis α) or TRAIL (tumor necrosis factor-related apoptosis-inducing ligand) - mediated activation of MEK/ERK (extracellular signal-regulated kinase). PEBP4 is also involved in myoblast differentiation. Additionally, it promotes Akt (RAC-α serine/threonine-protein kinase) activation. The gene is expressed in various cancers and is associated with cancer progression. The PEBP4 mRNA is a target of microRNA miR-34a.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: The gene PEBP4 (phosphatidylethanolamine binding protein 4) is mapped to human chromosome 8p21.3. It belongs to the PEBP family of proteins. The protein has potential glycosylation sites and can be secreted. It is mainly expressed in the skeletal muscle, heart and thyroid.
Immunogen: Phosphatidylethanolamine-binding protein 4 Precursor recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST76250
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top