Advanced Search



Anti-STK4 antibody produced in rabbit

SIGMA/HPA015270 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-MST-1; Anti-Mammalian STE20-like protein kinase 1; Anti-STE20-like kinase MST1; Anti-Serine/threonine-protein kinase 4; Anti-Serine/threonine-protein kinase Krs-2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA015270-100UL 100 µL
$607.00
1/EA
Add To Favorites
Enhanced Validation-RNAi Knockdown Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe no. 1, using Anti-STK4 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in cells outside reaction centra.
Immunofluorescence Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm, nuclear bodies and cytosol.
Western Blotting Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation RNAi knockdown
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence IEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEF
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity rat, mouse, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:50-1:200
UniProt accession no. Q13043 
Application: Anti-STK4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: STK4 (serine/threonine kinase 4) functions as both apoptotic and anti-apoptotic protein. It acts as an apoptotic protein upon its cleavage by caspases, which produces an N-terminal fragment of 36kDa. This fragment moves to the nucleus, where it phosphorylates histone proteins, resulting in apoptosis initiation. It also interacts with JNK (Jun N-terminal kinase) and RASSF1A (Ras association domain family member 1) to induce apoptosis. It phosphorylates FOXO1 (forkhead box O1) and FOXO3, which are transcription factors of FOXO family, in stress-response pathway. Thus, it maintains the viability of cell. Inactivation of this gene in lymphocytes and neutrophils leads to abnormal mitochondrial membrane potential. This results in increased chances of apoptotic death. Thus, loss of this gene, in humans is a cause of primary immunodeficiency syndrome. It is essential for the homing and maintenance of naïve T-cells, and deficiency in this gene leads to abnormal development and/or maintenance of regulatory T-cells.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: STK4 (serine/threonine kinase 4) is a kinase protein, which is ubiquitous in nature. It is homologous to yeast Ste20 and Drosophila Hippo protein. It has a molecular weight of 63kDa, and is a resident of the cytoplasm. It is also called MST1 (mammalian sterile 20-like protein), and has its active site at its N-terminal. It also contains an autoinhibitory domain, and a coiled-coil SARAH domain at its C-terminal. This domain is responsible for protein hetero- and homodimerization.
Immunogen: Serine/threonine-protein kinase 4 recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST73444
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top