Advanced Search



Anti-ZDHHC5 antibody produced in rabbit

SIGMA/HPA014670 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-DHHC-5; Anti-Palmitoyltransferase ZDHHC5, probable; Anti-Zinc finger DHHC domain-containing protein 5; Anti-Zinc finger protein 375

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA014670-100UL 100 µL
$607.00
1/EA
Add To Favorites
Western Blotting JOURNAL CITATION: Activity-regulated trafficking of the palmitoyl-acyl transferase DHHC5. By: Brigidi, G. S., Santyr, B., et al. in Nat Commun, 2015. PubMed ID: 26334723 Image collected and cropped by CiteAb from this publication, provided under a CC-BY license. Image might reflect a new usage that is not reflected in claims on product description or independently verified by Merck KGaA, Darmstadt, Germany. For Research Use Only. Not for use in diagnostic procedures.
Immunohistochemistry Immunohistochemical staining of human esophagus shows membranous positivity in squamous epithelial cells.
Immunohistochemistry Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells.
Immunohistochemistry Immunohistochemical staining of human cervix, uterine shows membranous positivity in squamous epithelial cells.
Immunohistochemistry Immunohistochemical staining of human duodenum shows membranous positivity in glandular cells.
Immunohistochemistry Immunohistochemical staining of human pancreas shows membranous positivity in exocrine glandular cells.
Immunofluorescence Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cell junctions.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous glycerol solution
immunogen sequence DPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHIVASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPLGRPAVPRFGKPDGLRGRGVGSPE
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:50-1:200
UniProt accession no. Q9C0B5 
Application: Anti-ZDHHC5 antibody produced in rabbit has been used in:
• microarray
• immunofluorescence
• immunoprecipitation
• coimmunoprecipitation

Application: Anti-ZDHHC5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: ZDHHC5 (zinc finger, DHHC-type containing 5) is a palmitoyl acyltransferase (PAT), which has its three cysteine residues S-acylated, within the CCX7-13C(S/T) motif. It is responsible for the palmitoylation of somatostatin receptor subtype 5 (SSTR5), which is a GPCR (G-protein coupled receptor). It might also be involved in the palmitoylation of other GPCRs, especially in the brain. This might explain its role in learning, memory and synaptic function. Also this protein is highly expressed in neurons, and might have an essential regulatory role in the neurons. Suppression of ZDHHC5 in mice, shows reduced learning capabilities, and this protein is also linked with neuropsychiatric disorders. This gene locus is also associated with bipolar disorder. It also palmitoylates GRIP1 (Glutamate receptor-interacting protein 1)b protein, and targets it to the endosomes of dendritic cells. This way it controls the trafficking of AMPA-R (α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor).
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: ZDHHC5 (zinc finger, DHHC-type containing 5) is a member of the family of integral membrane proteins called DHHC (Asp-His-His-Cys). This family has its palmitoyl acyltransferases (PAT) activity conserved through Saccharomyces cerevisiae to mammals. This family has 23 identified members in humans, out of which 17 exhibit PAT activity. ZDHHC5 protein and the mRNA are highly expressed in neurons. It is found in dendrites, in dendritic shafts, and rarely in dendritic spine. ZDHHC5 gene is localized to human chromosome 11. It has the characteristic DHHC domain, and has a highly elongated C-terminal. This C-terminal contains PDZ-binding domain, which is specific for type II PDZ-ligand
Immunogen: Palmitoyltransferase ZDHHC5, probable recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST72922
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top