Advanced Search



Anti-MARCH7 antibody produced in rabbit

SIGMA/HPA014275 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1

Synonym: Anti-AXOT; Anti-MARCH-VII; Anti-RNF177; Anti-membrane-associated ring finger (C3HC4) 7

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA014275-100UL 100 µL
$667.00
1/EA
Add To Favorites
Enhanced Validation-By Independent Antibodies Immunohistochemical staining of human cerebral cortex, colon, liver and lymph node using Anti-MARCH7 antibody HPA014275 (A) shows similar protein distribution across tissues to independent antibody HPA022152 (B).
Immunohistochemistry Immunohistochemical staining of human liver using Anti-MARCH7 antibody HPA014275.
Immunohistochemistry Immunohistochemical staining of human lymph node using Anti-MARCH7 antibody HPA014275.
Immunohistochemistry Immunohistochemical staining of human colon using Anti-MARCH7 antibody HPA014275.
Immunohistochemistry Immunohistochemical staining of human cerebral cortex using Anti-MARCH7 antibody HPA014275.
Immunofluorescence Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane and cytosol.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation independent
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence ILPGSLFRFAVPPALGSNLTDNVMITVDIIPSGWNSADGKSDKTKSAPSRDPERLQKIK
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:20-1:50
Application: Anti-MARCH7 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: The gene MARCH7 (membrane associated ring-CH-type finger 7) encodes a member of the MARCH family of seven membrane-associated E3 ubiquitin ligases. They contain a noncanonical RING domain called RING-CH-domain. The gene was first identified in mouse embryonic stem cells as a neural stem cell gene. The encoded protein is also referred to as Axotrophin. The gene is mapped to human chromosome 2. It has been found to be produced mainly in neural progenitor cells, intestinal crypt stem cells, megakaryocytes, trophoblasts, some lymphocytes and the splenic sinusoid, indicating a possible role in the development as well as the immune system. It has also been associated with the control of expression of the regulatory T-lymphocyte transcription factor Foxp3 and the suppressor of cytokine signalling 3 (SOCS3) gene.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
Immunogen: membrane-associated ring finger (C3HC4) 7 recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST72731
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top