Advanced Search



Anti-OPTN antibody produced in rabbit

SIGMA/HPA003279 - Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-FIP-2; Anti-FIP2; Anti-GLC1E; Anti-HIP7; Anti-HYPL; Anti-NRP; Anti-TFIIIA-INTP

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA003279-100UL 100 µL
$607.00
1/EA
Add To Favorites
Enhanced Validation-By Independent Antibodies Western blot analysis using Anti-OPTN antibody HPA003279 (A) shows similar pattern to independent antibody HPA003360 (B).
Enhanced Validation-Orthogonal RNAseq Confirmation Western blot analysis in human cell lines A-431 and HEK293 using Anti-OPTN antibody. Corresponding OPTN RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunohistochemistry Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in cells in granular layer.
Immunohistochemistry Immunohistochemical staining of human kidney shows weak cytoplasmic positivity in cells in tubules.
Immunofluorescence Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence LELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVL
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:200-1:500
UniProt accession no. Q96CV9 
Application: All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project  and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols   and other useful information.
Biochem/physiol Actions: OPTN (Optineurin) functions in several processes including vesicular trafficking from the Golgi to the plasma membrane, regulation of NF-κB, signal transduction and gene expression. It mediates the linking of myosin VI to the Golgi complex and functions in the formation of Golgi ribbon and exocytosis. It negatively regulates induction of IFNβ involved in antiviral signaling and serves as a potential target for antiviral therapy. It binds to Rab8 and regulates its association with TBC1D17, a Rab GTPase-activating protein, thus affecting Rab8-mediated processes, including the trafficking of transferrin receptor from the early endosome to the recycling endosome. Mutations in this gene cause primary open-angle glaucoma (POAG), a neurodegenerative eye disease that causes blindness.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: OPTN (optineurin) is a multifunctional 74kDa protein, which is composed of multiple coiled-coil domains, a leucine zipper, a ubiquitin-binding domain (UBD), and its C-terminus contains a C2H2 type zinc finger. It is expressed ubiquitously, and has predominant expression in brain, retina, heart, kidney, testis, skeletal muscle and placenta. It localizes to recycling endosomes, Golgi bodies and cytoplasm. This gene is localized to human chromosome 10p13.
Immunogen: Optineurin recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST85211
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top