Advanced Search



Anti-GOLGA5 antibody produced in rabbit

SIGMA/HPA000992 - affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Golgin subfamily A member 5 antibody produced in rabbit; Anti-Golgin-84 antibody produced in rabbit; Anti-RET-fused gene 5 protein antibody produced in rabbit; Anti-Ret-II protein antibody produced in rabbit

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA000992-100UL 100 µL
$667.00
1/EA
Add To Favorites
Enhanced Validation-Orthogonal RNAseq Confirmation Immunohistochemistry analysis in human epididymis and skeletal muscle tissues using HPA000992 antibody. Corresponding GOLGA5 RNA-seq data are presented for the same tissues.
Enhanced Validation-By Independent Antibodies Immunohistochemical staining of human cerebellum, epididymis, stomach and testis using Anti-GOLGA5 antibody HPA000992 (A) shows similar protein distribution across tissues to independent antibody HPA063876 (B).
Enhanced Validation-RNAi Knockdown Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe nos. 1 and 2, using Anti-GOLGA5 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry Immunofluorescence staining of mouse mesencephalic reticular formation shows strong immunoreactivity in a subset of neurons.
Immunohistochemistry Immunofluorescence staining of mouse hippocampus shows immunoreactivity in a subset of neurons in the CA3 area.
Immunohistochemistry Immunofluorescence staining of mouse thalamus shows positivity in neuronal cell bodies in ventral anterior nucleus.
Immunohistochemistry Immunofluorescence staining of mouse motor cortex shows strong cytoplasmic immunoreactivity in neurons.
Immunohistochemistry Immunofluorescence staining of mouse globus pallidus shows positivity in neuronal cell bodies.
Immunohistochemistry Immunohistochemical staining of human epididymis shows strong positivity in Golgi apparatus in glandular cells.
Immunohistochemistry Immunohistochemical staining of human testis shows moderate to strong granular cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry Immunohistochemical staining of human stomach shows moderate to strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry Immunohistochemical staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.
Immunofluorescence Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation independent
RNAi knockdown
independent
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence SSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACPDHTPTPNDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKV
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:200-1:500
UniProt accession no. Q8TBA6 
Application: Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunocytochemistry (1 paper) 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
Immunogen: Golgin subfamily A member 5 recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST70366
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top