Advanced Search



Anti-ATP5B (AB2) antibody produced in rabbit

SIGMA/AV48186 - IgG fraction of antiserum

Synonym: Anti-ATP synthase, H+ transporting, mitochondrial F1 complex, β polypeptide; Anti-ATPMB; Anti-ATPSB; Anti-MGC5231

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV48186-100UL 100 µL
$490.00
1/EA
Add To Favorites
Immunohistochemistry Anti-ATP5B (ab2): Cat. No. AV48186: Immunohistochemistry of ATP5B in tissue with ATP5B antibody at 4-8 μg/mL.
Immunohistochemistry Immunohistochemistry of ATP5B in Human Brain with ATP5B antibody at 4-8 μg/mL
Immunoblotting Cell Type: HepG2 (Cat. No. AV48186). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type HepG2
Western Blotting Western Blot of ATP5B in Human NT-2, mouse, rat brain with ATP5B antibody at 1 μg/mL
Western Blotting Western Blot of ATP5B in Human Fetal Liver, Human Fetal Lung, Human Ovary Tumor, Human 786-0 with ATP5B antibody at 1 μg/mL
Western Blotting Western Blot of ATP5B in Mouse Skeletal Muscle with ATP5B antibody at 1 μg/mL

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 52 kDa
NCBI accession no. NP_001677 
Quality Level 100 
shipped in wet ice
species reactivity rat, human, bovine, dog, guinea pig, mouse, rabbit, horse
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  immunoprecipitation (IP): suitable
  western blot: suitable
UniProt accession no. P06576 
Biochem/physiol Actions: ATP5B is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). ATP5B is the beta subunit of the catalytic core.This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the C terminal region of human ATP5B
Other Notes: Synthetic peptide located within the following region: MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top