Advanced Search



Anti-ATF5 (AB1) antibody produced in rabbit

SIGMA/AV100654 - affinity isolated antibody

Synonym: Anti-Activating transcription factor 5

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV100654-100UL 100 µL
$563.00
1/EA
Add To Favorites
Immunohistochemistry Anti-ATF5 (ab1): Cat. No. AV100654: Immunohistochemistry of ATF5 in Human Intestine tissue with ATF5 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: fetal lung (Cat. No. AV100654). Lanes 1. Antibody dilution (concentration) 0.5 μg/mL in cell type fetal lung

 

antibody form affinity isolated antibody
antibody product type primary antibodies
clone polyclonal
concentration 0.5 mg - 1 mg/mL
form buffered aqueous solution
mol wt 31 kDa
NCBI accession no. NP_036200 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q9Y2D1 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the N terminal region of human ATF5
Other Notes: Synthetic peptide located within the following region: MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGG
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top