Advanced Search



CD86 human

SIGMA/5096 - recombinant, expressed in E. coli, 0.5 mg protein/mL

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-5096-100UG 100 µg
$349.00
1/EA
Add To Favorites
This image is provided for informative purposes only and does not represent an actual product label. It should not be used as a substitute for official product labeling.

 

accession no. NP_008820
assay ≥90% (SDS-PAGE)
biological source human
concentration 0.5 mg protein/mL
description 0.1 mg recombinant human CD86 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.
form liquid
packaging pkg of 100 μg
recombinant expressed in E. coli
sterility Filtered sterilized solution
storage temp. −20°C
UniProt accession no. P42081 
Application: Coating a plate well (6 well plate) with this recombinant CD86 protein in T cell specific medium at 1-10 μg/well allows for use as 1) a coating matrix protein for human T cell/ receptor interaction or as a highly purified recombinant antigen or 2) as a culture matrix protein for T cell differentiation regulation studies in vitro.

Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD86 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
2. Add appropriate amount of diluted material to culture surface.
3. Incubate at room temperature for approximately 1.5 hours.
4. Aspirate remaining material.
5. Rinse plates carefully with water and avoid scratching bottom surface of plates.
6. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained.
Other Notes: MASMTGGQQMGRGHHHHHHGNLYFQGGEFELPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Preparation Note: The full-length extracellular domain of the human CD86 gene (24 - 247 aa, Isoform-2) was constructed with 31 N-terminal T7/HIS-tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified as soluble protein.
RIDADR NONH for all modes of transport
WGK Germany WGK 2
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Purity ≥90% (SDS-PAGE)
Storage Temp. −20°C
UNSPSC 12352200

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top