Advanced Search



Anti-HSPA13 antibody produced in rabbit

SIGMA/HPA014797 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Microsomal stress 70 protein ATPase core; Anti-STCH antibody produced in rabbit; Anti-Stress 70 protein chaperone microsome-associated 60 kDa protein precursor

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA014797-100UL 100 µL
$598.00
1/EA
Add To Favorites
Immunohistochemistry Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.
Immunohistochemistry Immunohistochemical staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts and leydig cell.
Immunohistochemistry Immunohistochemical staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous glycerol solution
immunogen sequence AYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDH
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: 1:20-1:50
UniProt accession no. P48723 
Application: All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project  and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols   and other useful information.
Biochem/physiol Actions: HSPA13 (heat shock protein 70kDa family, member 13) is responsible for processing both secretory and cytoplasmic proteins. It binds to misfolded or denatured peptides, and then uses ATP-derived energy to release them. Unlike other members of HSP70 family, which are induced by heat shock, this protein is activated by Ca2+ ionophore A23187. Studies in Japanese population show that variants of this gene might be linked to susceptibility to gastric cancer. This protein is capable of modulating TRAIL-mediated cell apoptosis, and hence, plays a key role in cell survival. It interacts with pH-regulating transporters NBCe1-B and NHE1, and modulates their membrane expression. Therefore, it regulates intracellular pH during stress, and facilitates cellular recovery from acidification. Mutations in this gene have been shown to be associated with Alzheimer′s disease, epilepsy and autism. It is also thought to be involved in regulating plasticity.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: HSPA13 (heat shock protein 70kDa family, member 13) belongs to the heat shock protein 70 chaperone family. It has a highly conserved N-terminal domain, which contains the ATPase domain, and a unique hydrophobic leader sequence. It is a constitutively and ubiquitously expressed gene, and the encoded protein has a molecular weight of 60kDa. This gene is localized to human chromosome 21q11.1. It is localized to the microsomal region of the cell.
Immunogen: Stress 70 protein chaperone microsome-associated 60 kDa protein precursor (Microsomal stress 70 protein ATPase core).
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST72076
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top