Advanced Search



Anti-ALDH9A1 antibody produced in rabbit

SIGMA/HPA010873 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-γ-Aminobutyraldehyde dehydrogenase antibody produced in rabbit; Anti-4-Trimethylaminobutyraldehyde dehydrogenase antibody produced in rabbit; Anti-Aldehyde dehydrogenase 9A1 antibody produced in rabbit; Anti-Aldehyde dehydrogenase E3 isozyme antibody produced in rabbit; Anti-R-aminobutyraldehyde dehydrogenase antibody produced in rabbit; Anti-TMABADH antibody produced in rabbit

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA010873-25UL 25 µL
$294.00
1/EA
Add To Favorites
45-HPA010873-100UL 100 µL
$570.00
1/EA
Add To Favorites
Immunohistochemistry Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blotting Western blot analysis in human cell line TD47D.
Western Blotting Western blot analysis in rat cell line NBT-II.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous glycerol solution
immunogen sequence DCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFD
packaging antibody small pack of 25 μL
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity rat, human
storage temp. −20°C
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunohistochemistry: 1:200-1:500
UniProt accession no. P49189 
Application: Anti-ALDH9A1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Application: Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper) 
Biochem/physiol Actions: ALDH9A1 (aldehyde dehydrogenase 9 family, member A1) is a cytoplasmic enzyme which is involved in the metabolism of aminoaldehydes. In liver, this enzyme catalyzes the synthesis of γ-Aminobutyric acid (GABA) from γ-aminobutyraldehyde. In brain, ALDH9A1 catalyzes dehydrogenation of aldehydes such as, betaine aldehyde, acetaldehyde, propionaldehyde along with that of γ-aminobutyraldehyde. This enzyme is also thought to be involved in the production of GABA from putrescine, either directly through diamine oxidase, or indirectly through acetylated putrescine via monoamine oxidase. Studies suggest that ALDH9A1 might be the predominant aldehyde dehydrogenase responsible for carnitine biosynthesis.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: ALDH9A1 (aldehyde dehydrogenase 9 family, member A1) gene encodes an aldehyde dehydrogenase isozyme. This gene maps to human chromosome 1q22-q23, and spans 45kb consisting of 10 exons. It has an open reading frame of 1479bp. The encoded protein consists of 493 amino acids. This gene is highly expressed in skeletal muscle, kidney and adult liver, and has lower expression in lung, pancreas, heart and brain.
Immunogen: 4-Trimethylaminobutyraldehyde dehydrogenase recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antigen APREST70697 .
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top