Advanced Search



Anti-ABCA3 antibody produced in rabbit

SIGMA/HPA007884 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-ABC-C transporter antibody produced in rabbit; Anti-ATP-binding cassette 3 antibody produced in rabbit; Anti-ATP-binding cassette sub-family A member 3 antibody produced in rabbit; Anti-ATP-binding cassette transporter 3 antibody produced in rabbit

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA007884-100UL 100 µL
$555.00
1/EA
Add To Favorites
Enhanced Validation-Orthogonal RNAseq Confirmation Immunohistochemistry analysis in human lung and cervix, uterine tissues using HPA007884 antibody. Corresponding ABCA3 RNA-seq data are presented for the same tissues.
Immunohistochemistry Immunohistochemical staining of human lung shows strong positivity in pneumocytes.
Immunohistochemistry Immunohistochemical staining of human cerebellum shows positivity in Purkinje cells.
Immunohistochemistry Immunohistochemical staining of human liver shows weak cytoplasmic positivity in hepatocytes.
Immunohistochemistry Immunohistochemical staining of human cervix shows no positivity in squamous epithelial cells as expected.
Immunofluorescence Immunofluorescent staining of human cell line HUVEC TERT2 shows localization to nucleoplasm & cytosol.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation orthogonal RNAseq
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence MLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDALQAEGQEPREVLGDLEEFLIFRASVEGGGFNERCLVAASFRDVGERTVVNALFNNQAYHSPATALAVVDNLLFKLLCGPHASIVVSNFPQPRSALQAAKDQFNEG
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:50-1:200
UniProt accession no. Q99758 
Application: Anti-ABCA3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: ABCA3 (ATP-binding cassette, sub-family A, member3) gene encodes a member of the ABC1 subfamily and is mainly localized to the limiting membrane of the lamellar bodies in human lung. It functions in the transmembrane transport of lipid components of pulmonary surfactant. It is involved in the metabolism of pulmonary surfactant lipids and in the biogenesis of lamellar body. Mutations in this gene are associated with fatal surfactant deficiency in neonates resulting in lethal respiratory distress and interstitial lung disease.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: ABCA3 (ATP-binding cassette, sub-family A, member3) gene encodes a member of the ABCA subclass of ATP-binding cassette (ABC) transporters. Its expression is restricted to lungs in the type II cells expressing surfactant protein A. Its expression is up-regulated by glucocorticoids just before birth.
Immunogen: ATP-binding cassette sub-family A member 3 recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST86886
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top