Advanced Search



Anti-BCAN antibody produced in rabbit

SIGMA/HPA007865 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Brain-enriched hyaluronan-binding protein antibody produced in rabbit; Anti-Brevican core protein precursor antibody produced in rabbit; Anti-Protein BEHAB antibody produced in rabbit

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA007865-25UL 25 µL
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
45-HPA007865-100UL 100 µL
$598.00
1/EA
Add To Favorites
Enhanced Validation-Orthogonal RNAseq Confirmation Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA007865 antibody. Corresponding BCAN RNA-seq data are presented for the same tissues.
Immunohistochemistry Immunohistochemical staining of human Cerebral cortex shows strong positivity in neuronal processes in neuropil.
Immunohistochemistry Immunohistochemical staining of human Prostate shows no positivity in glandular cells as expected.
Immunohistochemistry Immunohistochemical staining of human Liver shows no positivity in hepatocytes as expected.
Immunohistochemistry Immunohistochemical staining of human Pancreas shows no positivity in exocrine glandular cells as expected.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation orthogonal RNAseq
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence ACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFR
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: 1:200-1:500
UniProt accession no. Q96GW7 
Application: Anti-BCAN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Application: Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper) 
Western Blotting (1 paper) 
Biochem/physiol Actions: Brevican is a proteoglycan that functions in the formation of extracellular matrix in the brain. Its expression in the brain increases as the brain develops. It plays a role in the maintenance of the extracellular environment of mature brain. The proteoglycans function in cell-cell and cell-matrix interactions in the brain.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: BCAN (brevican) gene encodes a chondroitin sulfate proteoglycan that is a member of the aggrecan/versican family. The gene is mapped to human chromosome 1q31. The N-terminal region contains a hyaluronic acid-binding domain. An epidermal growth factor-like repeat, a lectin-like and a complement regulatory protein-like domains are present at the C-terminal region. It is the smallest core protein in this family and is expressed in the developing and adult brain. It is expressed in primary cerebellar astrocytes but not in neurons. The core protein has a molar mass of 145kDa and the N terminally truncated form has a molar mass of 80Da.
Immunogen: Brevican core protein precursor recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST71572
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top