Advanced Search



Anti-EGFR antibody produced in rabbit

SIGMA/HPA001200 - Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Epidermal growth factor receptor precursor antibody produced in rabbit; Anti-Receptor tyrosine-protein kinase ErbB-1 antibody produced in rabbit

MDL Number: MFCD00162282
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA001200-100UL 100 µL
$573.00
1/EA
Add To Favorites
Enhanced Validation-Orthogonal RNAseq Confirmation Immunohistochemistry analysis in human placenta and pancreas tissues using HPA001200 antibody. Corresponding EGFR RNA-seq data are presented for the same tissues.
Immunohistochemistry Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemistry Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry Immunohistochemical staining of human testis shows no in cells in seminiferous ducts as expected.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
application(s) research pathology
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation orthogonal RNAseq
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence EFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIS
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: 1:50-1:200
UniProt accession no. P00533 
Application: Anti-EGFR antibody produced in rabbit is suitable for use in epitope mapping to study the antibody cross-reactivity with a multi-target fragment library.
Anti-EGFR antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: Epidermal growth factor receptor (EGFR) plays an important role in cell proliferation, survival, and differentiation. Interaction between EGFR and its ligands results in stimulation of several transduction pathways including the RAS/RAF/MEK/MAPK, PLC-γ/PKC, PI3K/AKT, JAK/STAT, and NF-κB cascades. Presence of ligand stimulates EGFR phosphorylation. This event subsequently recruits ubiquitin ligase, CBL, to EGFR. Activated EGFR-ligand complex is removed from the cell surface via endocytosis and is degraded in the lysosomes to attenuate the signaling. EGFR hyper-phosphorylation is linked to cell proliferation and thereby tumor development. EGFR is associated with a number of human solid tumors, including lung, breast, prostate, bladder, colon, head and neck, ovarian and salivary duct carcinomas.
Density-enhanced phosphatase-1 (DEP1) dephosphorylates and thereby stabilizes EGFR. The transmembrane protein LRIG1 and suppressors of cytokine signaling-5 (SOCS5) binds and destabilizes EGFR. Protein tyrosine phosphatase PTPN3 and PHD3 promotes EGFR endocytic degradation.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: The gene epidermal growth factor receptor (EGFR) is mapped to human chromosome 7p12. It belongs to receptor tyrosine kinase family. The protein is mainly localized in the plasma membrane.
Immunogen: Epidermal growth factor receptor precursor recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST78874
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top